(data stored in ACNUC7421 zone)

EMBL: CP000478.PE573

CP000478.PE573       Location/Qualifiers
FT   CDS             704438..704767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0578"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /note="KEGG: sat:SYN_01067 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16277"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS5"
FT                   /protein_id="ABK16277.1"
FT                   /translation="MKLRLPENIFQSIPDEIPEEVCEAIVRTDTIVIERIVSHGQASHE
FT                   GFWYDQEKSEWVMVLQGRAGLLFEGWEEPVVLQTGDWINIPAHAKHRVEWTDPNEKTIW
FT                   LAVYY"
     MKLRLPENIF QSIPDEIPEE VCEAIVRTDT IVIERIVSHG QASHEGFWYD QEKSEWVMVL        60
     QGRAGLLFEG WEEPVVLQTG DWINIPAHAK HRVEWTDPNE KTIWLAVYY                   109
//

If you have problems or comments...

PBIL Back to PBIL home page