(data stored in ACNUC7421 zone)

EMBL: CP000478.PE575

CP000478.PE575       Location/Qualifiers
FT   CDS             705847..706170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16279"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS7"
FT                   /protein_id="ABK16279.1"
FT                   /translation="MEGRCKRHTHYTTDVFYRPLQASSPAAGGLGAYSVTYAYDQRANG
FT                   KGHLTTVTDPSGSTLSNHDARSRLWEKKSTVSGFEFTFSRAFSPAGRLRRVEVGPVSGS
FT                   SRG"
     MEGRCKRHTH YTTDVFYRPL QASSPAAGGL GAYSVTYAYD QRANGKGHLT TVTDPSGSTL        60
     SNHDARSRLW EKKSTVSGFE FTFSRAFSPA GRLRRVEVGP VSGSSRG                     107
//

If you have problems or comments...

PBIL Back to PBIL home page