(data stored in ACNUC7421 zone)

EMBL: CP000478.PE578

CP000478.PE578       Location/Qualifiers
FT   CDS             709512..709883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0583"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   aba:Acid345_3714 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16282"
FT                   /db_xref="GOA:A0LFT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT0"
FT                   /protein_id="ABK16282.1"
FT                   /translation="MTWKQCTVFVADDDKSVLESLALLLESAGYQSRGFGSAEELLASG
FT                   SVQNACCLILDIKLPGMSGLQLLQVLAASHTPIPVVFITGHDCPGIEAQALGLGAVAYL
FT                   RKPFDEQMLLDAIHPYCVN"
     MTWKQCTVFV ADDDKSVLES LALLLESAGY QSRGFGSAEE LLASGSVQNA CCLILDIKLP        60
     GMSGLQLLQV LAASHTPIPV VFITGHDCPG IEAQALGLGA VAYLRKPFDE QMLLDAIHPY       120
     CVN                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page