(data stored in ACNUC7421 zone)

EMBL: CP000478.PE579

CP000478.PE579       Location/Qualifiers
FT   CDS             709946..710824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16283"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT1"
FT                   /protein_id="ABK16283.1"
FT                   /translation="MRPDTFMKVFASMVLSIMLGGCVQSMRSPALKHAEASGTTETAPV
FT                   VKKNPAEVAASPSGYPFDSAEARRKVNQYETELQRNGGRRDIALVELARLCFTLGELGE
FT                   KSESELHFNKGRYYAECLSKEQPARVEGHYWLAMNLAGLARAGGAGRSLRLLSVIVDEL
FT                   KVALGIDETYDKGGPHRVLGRIRCKAPVWPLSEGNMDQSLEHLRAAVVIAPENSTNHLF
FT                   LAETLYQLGKTEEAVQELERVVSSSCRAAYSAGARDDCQEALALLKKCREEQNCEPAGK
FT                   SVNVASPGKAR"
     MRPDTFMKVF ASMVLSIMLG GCVQSMRSPA LKHAEASGTT ETAPVVKKNP AEVAASPSGY        60
     PFDSAEARRK VNQYETELQR NGGRRDIALV ELARLCFTLG ELGEKSESEL HFNKGRYYAE       120
     CLSKEQPARV EGHYWLAMNL AGLARAGGAG RSLRLLSVIV DELKVALGID ETYDKGGPHR       180
     VLGRIRCKAP VWPLSEGNMD QSLEHLRAAV VIAPENSTNH LFLAETLYQL GKTEEAVQEL       240
     ERVVSSSCRA AYSAGARDDC QEALALLKKC REEQNCEPAG KSVNVASPGK AR               292
//

If you have problems or comments...

PBIL Back to PBIL home page