(data stored in ACNUC7421 zone)

EMBL: CP000478.PE580

CP000478.PE580       Location/Qualifiers
FT   CDS             711087..711902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16284"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT2"
FT                   /protein_id="ABK16284.1"
FT                   /translation="MILRKLLIAVICLLSACLVAAPGSAAQGQAAVPSGSQADGMAILM
FT                   RTANFLAQAGQFSFRLSAGYDVLQETGQKIEFGEVRQVTLVRPDRMRVDTERSDGEKAQ
FT                   AIFNGQEIIVYSPGDKVYATAGKPGDLDSALRYLVNDLQLRLPLSLMYVRDFPAELERR
FT                   MLSVDVVEKVAAMDVPCIHLAGRTDTVDFQFWIPTEGDPLPRRVVMTYKLAEGQPQFWA
FT                   NFTEWNLSPNPPQGFFSFTPPEGVQRIAFLAELEVAKPDVKKVKKGGKK"
     MILRKLLIAV ICLLSACLVA APGSAAQGQA AVPSGSQADG MAILMRTANF LAQAGQFSFR        60
     LSAGYDVLQE TGQKIEFGEV RQVTLVRPDR MRVDTERSDG EKAQAIFNGQ EIIVYSPGDK       120
     VYATAGKPGD LDSALRYLVN DLQLRLPLSL MYVRDFPAEL ERRMLSVDVV EKVAAMDVPC       180
     IHLAGRTDTV DFQFWIPTEG DPLPRRVVMT YKLAEGQPQF WANFTEWNLS PNPPQGFFSF       240
     TPPEGVQRIA FLAELEVAKP DVKKVKKGGK K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page