(data stored in ACNUC7421 zone)

EMBL: CP000478.PE585

CP000478.PE585       Location/Qualifiers
FT   CDS             716855..717346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16289"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT7"
FT                   /protein_id="ABK16289.1"
FT                   /translation="MMKKHKVVLTVFLIAAVVLAAAPVPAQEKAADNMQIVLEKARADK
FT                   KLLVAGNMQLTEAEGKVFWPVYERYQDELFLLRARTLKLLDDYADSYEKLTNEMAKKLL
FT                   DEYMTIETLRLKLHQAYLPKFRKALPDKKVARYYQIENKVQAALMYEFARKIPLAKTDG
FT                   "
     MMKKHKVVLT VFLIAAVVLA AAPVPAQEKA ADNMQIVLEK ARADKKLLVA GNMQLTEAEG        60
     KVFWPVYERY QDELFLLRAR TLKLLDDYAD SYEKLTNEMA KKLLDEYMTI ETLRLKLHQA       120
     YLPKFRKALP DKKVARYYQI ENKVQAALMY EFARKIPLAK TDG                         163
//

If you have problems or comments...

PBIL Back to PBIL home page