(data stored in ACNUC7421 zone)

EMBL: CP000478.PE587

CP000478.PE587       Location/Qualifiers
FT   CDS             718069..718344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lip:LI0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16291"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT9"
FT                   /protein_id="ABK16291.1"
FT                   /translation="MIFLNPLLGMAAGATAGTVGGALADVGINGKFMKELAAQLHPNSS
FT                   ALFVLARKATPDKVLDEIKGTGGKILQTSLSHENEAKLAAVLADNQ"
     MIFLNPLLGM AAGATAGTVG GALADVGING KFMKELAAQL HPNSSALFVL ARKATPDKVL        60
     DEIKGTGGKI LQTSLSHENE AKLAAVLADN Q                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page