(data stored in ACNUC7421 zone)

EMBL: CP000478.PE588

CP000478.PE588       Location/Qualifiers
FT   CDS             719119..720249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0593"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mca:MCA0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16292"
FT                   /db_xref="GOA:A0LFU0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU0"
FT                   /protein_id="ABK16292.1"
FT                   /translation="MNIPSQSDYEFEQRVASRFMDILIRAGLILVLAMLCYQVLSPFLT
FT                   LMVWALILAVTIFPLHQFLAGRIGGRQGLAAALLVIVGLMLIVVPTAMLMSSLGDSVHQ
FT                   LVNDVQNNSLKIPAPRPGVEGWPVVGKKVHDIWSRAYADLPALVQSMQPKIGELAKTAL
FT                   GFVAGIAGGLLQFIASFIVAGIIMAFGQSGGRGSLAIFERIVGRERGGEFARLSTSTIR
FT                   AVSQGVIGVAFIQAIIVGLALLVSGVPWAGALALIVLVLGIAQIPALIVTLPAIVYIWM
FT                   SGHYGNAAAVAYTVVLILSGMTDNVLKPLMLGRGVDAPMPVILLGALGGMGTAGILGMF
FT                   VGATLLTLGYQVFMGWVAANPDAGQAQAESESQQAG"
     MNIPSQSDYE FEQRVASRFM DILIRAGLIL VLAMLCYQVL SPFLTLMVWA LILAVTIFPL        60
     HQFLAGRIGG RQGLAAALLV IVGLMLIVVP TAMLMSSLGD SVHQLVNDVQ NNSLKIPAPR       120
     PGVEGWPVVG KKVHDIWSRA YADLPALVQS MQPKIGELAK TALGFVAGIA GGLLQFIASF       180
     IVAGIIMAFG QSGGRGSLAI FERIVGRERG GEFARLSTST IRAVSQGVIG VAFIQAIIVG       240
     LALLVSGVPW AGALALIVLV LGIAQIPALI VTLPAIVYIW MSGHYGNAAA VAYTVVLILS       300
     GMTDNVLKPL MLGRGVDAPM PVILLGALGG MGTAGILGMF VGATLLTLGY QVFMGWVAAN       360
     PDAGQAQAES ESQQAG                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page