(data stored in ACNUC7421 zone)

EMBL: CP000478.PE589

CP000478.PE589       Location/Qualifiers
FT   CDS             complement(720629..720904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0594"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: dde:Dde_1512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16293"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU1"
FT                   /protein_id="ABK16293.1"
FT                   /translation="MTAKDITMPLFDFLCLECGKTSEVLVTSSNASPACSECGSVKLKK
FT                   LLSAPSSLSGAPRHGLPGAGDTACCGSSPAQAHCAGPGSCCGRNSG"
     MTAKDITMPL FDFLCLECGK TSEVLVTSSN ASPACSECGS VKLKKLLSAP SSLSGAPRHG        60
     LPGAGDTACC GSSPAQAHCA GPGSCCGRNS G                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page