(data stored in ACNUC7421 zone)

EMBL: CP000478.PE594

CP000478.PE594       Location/Qualifiers
FT   CDS             complement(724110..724682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0599"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   bte:BTH_I1723 RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16298"
FT                   /db_xref="GOA:A0LFU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU6"
FT                   /protein_id="ABK16298.1"
FT                   /translation="MEEDRAVIARIKNGDTGAFAVLVQKYQGRLLTFIHRMVRDGKIVE
FT                   DIGQEVFLDVYKSLRNFDETRGTPFSAWLFIAARNRCVNELRKRTGEHCVHIDAVDAAD
FT                   LGVDLRTAEHLLLEHERRSALRDSLAKISEPLRKPIFMWLNGGSLAEIAEACGVSPGTV
FT                   KSRLFRAREKVRVCVQHQAGGKNHDGV"
     MEEDRAVIAR IKNGDTGAFA VLVQKYQGRL LTFIHRMVRD GKIVEDIGQE VFLDVYKSLR        60
     NFDETRGTPF SAWLFIAARN RCVNELRKRT GEHCVHIDAV DAADLGVDLR TAEHLLLEHE       120
     RRSALRDSLA KISEPLRKPI FMWLNGGSLA EIAEACGVSP GTVKSRLFRA REKVRVCVQH       180
     QAGGKNHDGV                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page