(data stored in ACNUC7421 zone)

EMBL: CP000478.PE595

CP000478.PE595       Location/Qualifiers
FT   CDS             complement(724768..725277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0600"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mag:amb3944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16299"
FT                   /db_xref="GOA:A0LFU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU7"
FT                   /protein_id="ABK16299.1"
FT                   /translation="MPTTESPFAGRSFALGACLLERLEEADARPLAKILLSNEPWLTLH
FT                   STLDGIQRYFLRRDPGLWRFTARFDGAPGGVVCVRHPWLFGPYLELIALDRPYQGQGVG
FT                   RDIVRWMERQAKPVSANIWTLVSAFNEPAQRFYAGLGFEEIVPIRDLVIAGHVEILMRK
FT                   TLEEPR"
     MPTTESPFAG RSFALGACLL ERLEEADARP LAKILLSNEP WLTLHSTLDG IQRYFLRRDP        60
     GLWRFTARFD GAPGGVVCVR HPWLFGPYLE LIALDRPYQG QGVGRDIVRW MERQAKPVSA       120
     NIWTLVSAFN EPAQRFYAGL GFEEIVPIRD LVIAGHVEIL MRKTLEEPR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page