(data stored in ACNUC7421 zone)

EMBL: CP000478.PE597

CP000478.PE597       Location/Qualifiers
FT   CDS             complement(726572..726946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB8370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16301"
FT                   /db_xref="GOA:A0LFU9"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU9"
FT                   /protein_id="ABK16301.1"
FT                   /translation="MPVFVRIVLLGSAVLLLVLTGTQPRTDAASPVYADVAKIFQKHCT
FT                   SCHSGARAPDKFRMETYMDVMQGGRNGAMVLPGDPAGSEIIRRVKGASTPRMPKNGPPW
FT                   LSADEVRVLEKWVENGAPEA"
     MPVFVRIVLL GSAVLLLVLT GTQPRTDAAS PVYADVAKIF QKHCTSCHSG ARAPDKFRME        60
     TYMDVMQGGR NGAMVLPGDP AGSEIIRRVK GASTPRMPKN GPPWLSADEV RVLEKWVENG       120
     APEA                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page