(data stored in ACNUC7421 zone)

EMBL: CP000478.PE6

CP000478.PE6         Location/Qualifiers
FT   CDS             complement(6663..7736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0006"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: sat:SYN_00471 arabinose-5-phosphate isomerase;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15710"
FT                   /db_xref="GOA:A0LE58"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE58"
FT                   /protein_id="ABK15710.1"
FT                   /translation="MTKSAHRAGGPQEEPSAVPLLRKGSTEHPAASTKGILEIAADVLR
FT                   IESEGILHLLDHISESFARAVLWIYEAGGRIIVTGIGKSGIVGRKIVATLSSTGTPALF
FT                   IHPVEAMHGDLGMVRAGDIVLALSNSGETDELNIILPSLKNIGTRIIAFTGDTSSTLAQ
FT                   YSDLTVYTGVPREACPMGLVPTASTTAMLAMGDALAVALLRLRNFQERDFHRFHPGGHL
FT                   GERLQVPLRDVMLKGDEIPAVPAATPVPAALAEMSRKGLGATLILDEDKRLQGIFTDGD
FT                   LRRTLNSCSNFTEKRISEVMTPGPRTISSHRSVADALELMERHLITVLPVVDENRNVEG
FT                   ILHLHDLLGKGRIRFSR"
     MTKSAHRAGG PQEEPSAVPL LRKGSTEHPA ASTKGILEIA ADVLRIESEG ILHLLDHISE        60
     SFARAVLWIY EAGGRIIVTG IGKSGIVGRK IVATLSSTGT PALFIHPVEA MHGDLGMVRA       120
     GDIVLALSNS GETDELNIIL PSLKNIGTRI IAFTGDTSST LAQYSDLTVY TGVPREACPM       180
     GLVPTASTTA MLAMGDALAV ALLRLRNFQE RDFHRFHPGG HLGERLQVPL RDVMLKGDEI       240
     PAVPAATPVP AALAEMSRKG LGATLILDED KRLQGIFTDG DLRRTLNSCS NFTEKRISEV       300
     MTPGPRTISS HRSVADALEL MERHLITVLP VVDENRNVEG ILHLHDLLGK GRIRFSR          357
//

If you have problems or comments...

PBIL Back to PBIL home page