(data stored in ACNUC7421 zone)

EMBL: CP000478.PE61

CP000478.PE61        Location/Qualifiers
FT   CDS             complement(77970..78908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0062"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: dps:DP0437 probable ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15765"
FT                   /db_xref="GOA:A0LEB3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB3"
FT                   /protein_id="ABK15765.1"
FT                   /translation="MKRDLLSIRDLSADEIVALISRAETMKRELAEGNLRQSLRNKVVA
FT                   LIFVKPSTRTRVSFEAAIYRLGGHSIFMSARDTQISRQEPLADTARVLARYVDAIVIRT
FT                   FAQEDVTELARYASIPVINGLTDRTHPCQVLGDLLTIKEKRGTLEGLHVAWIGDGNNVA
FT                   HSWINAAARLGFTVSLACPSQYLPDREILDWADTQGKGKVIMAASPKEAVASADAIYTD
FT                   VWASMGQEEEADARRSIFRPFQVNEELLSAAPAHAIVLHCLPAHRGEEITNAVMEGPHS
FT                   AIFDQAENRLHIQMALLDWLLSDNAPTQGSK"
     MKRDLLSIRD LSADEIVALI SRAETMKREL AEGNLRQSLR NKVVALIFVK PSTRTRVSFE        60
     AAIYRLGGHS IFMSARDTQI SRQEPLADTA RVLARYVDAI VIRTFAQEDV TELARYASIP       120
     VINGLTDRTH PCQVLGDLLT IKEKRGTLEG LHVAWIGDGN NVAHSWINAA ARLGFTVSLA       180
     CPSQYLPDRE ILDWADTQGK GKVIMAASPK EAVASADAIY TDVWASMGQE EEADARRSIF       240
     RPFQVNEELL SAAPAHAIVL HCLPAHRGEE ITNAVMEGPH SAIFDQAENR LHIQMALLDW       300
     LLSDNAPTQG SK                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page