(data stored in ACNUC7421 zone)

EMBL: CP000478.PE63

CP000478.PE63        Location/Qualifiers
FT   CDS             complement(80165..81061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0064"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: sat:SYN_02154 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15767"
FT                   /db_xref="GOA:A0LEB5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB5"
FT                   /protein_id="ABK15767.1"
FT                   /translation="MIEKAGILIEALPYIRRFYGKTVVIKYGGNAMVAEELKESFAKDI
FT                   VLMKYIGINPVVVHGGGPQIGRMLKRIGKESDFCAGMRVTDADTMDIVEMVLAGKINKE
FT                   IVSLINRHGGHAVGLSGKDGNLIEARKLHVYRYKGDDQPPEIIDIGLVGEVNRVNVSIL
FT                   DTLAGGNLIPVIAPVGVGEQGETYNINADLVAGHIAGALQAAKLVLMTDVEGVLDGGGN
FT                   LISSLTVAEAADALQDETLKGGMIPKVQCAIDALQSGVDKVHIVDGRVPHAILLEIFTD
FT                   AGVGTEIVRYRRGQSVG"
     MIEKAGILIE ALPYIRRFYG KTVVIKYGGN AMVAEELKES FAKDIVLMKY IGINPVVVHG        60
     GGPQIGRMLK RIGKESDFCA GMRVTDADTM DIVEMVLAGK INKEIVSLIN RHGGHAVGLS       120
     GKDGNLIEAR KLHVYRYKGD DQPPEIIDIG LVGEVNRVNV SILDTLAGGN LIPVIAPVGV       180
     GEQGETYNIN ADLVAGHIAG ALQAAKLVLM TDVEGVLDGG GNLISSLTVA EAADALQDET       240
     LKGGMIPKVQ CAIDALQSGV DKVHIVDGRV PHAILLEIFT DAGVGTEIVR YRRGQSVG         298
//

If you have problems or comments...

PBIL Back to PBIL home page