(data stored in ACNUC7421 zone)

EMBL: CP000478.PE64

CP000478.PE64        Location/Qualifiers
FT   CDS             complement(81161..82561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0065"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: sat:SYN_02153 ATP-dependent endopeptidase hsl
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15768"
FT                   /db_xref="GOA:A0LEB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB6"
FT                   /protein_id="ABK15768.1"
FT                   /translation="MQKPLTPAEIVQELDKYIIGQRDAKRMVAIALRNRWRRQQVPEHL
FT                   RDEIAPKNIIMIGPTGVGKTEIARRLARLAQSPFLKIEASKFTEVGYVGRDVESMIRDL
FT                   SELAVSMVRTEEMEAVKIKAEELAEEKLLDILLPPKRQQESREQELPVPVEPQEAREPR
FT                   EAAREEAVQADSTREKLRKLLRKGALDDRYVELDVPDRNFPMVEIFAGTGMEDMDYNLR
FT                   DMLGSMLPRRTKRRKVKIPEAREILVQEESQRLIDMDKVIKSAIERVEHSGIIFLDEID
FT                   KIAGRESGGRGPDVSREGVQRDLLPIVEGSTVTTKYGMVKTDHILFIASGAFHISKPSD
FT                   LIPELQGRFPIRVELASLTKEDFVRILKEPENALIVQYKSLLATEEVELTFDDEAIEEI
FT                   AGLAFQVNARTENIGARRLHTIMEKLLSDISFNAPDLKGQKIPITRQYIQETLSDIIKD
FT                   EDLSRYIL"
     MQKPLTPAEI VQELDKYIIG QRDAKRMVAI ALRNRWRRQQ VPEHLRDEIA PKNIIMIGPT        60
     GVGKTEIARR LARLAQSPFL KIEASKFTEV GYVGRDVESM IRDLSELAVS MVRTEEMEAV       120
     KIKAEELAEE KLLDILLPPK RQQESREQEL PVPVEPQEAR EPREAAREEA VQADSTREKL       180
     RKLLRKGALD DRYVELDVPD RNFPMVEIFA GTGMEDMDYN LRDMLGSMLP RRTKRRKVKI       240
     PEAREILVQE ESQRLIDMDK VIKSAIERVE HSGIIFLDEI DKIAGRESGG RGPDVSREGV       300
     QRDLLPIVEG STVTTKYGMV KTDHILFIAS GAFHISKPSD LIPELQGRFP IRVELASLTK       360
     EDFVRILKEP ENALIVQYKS LLATEEVELT FDDEAIEEIA GLAFQVNART ENIGARRLHT       420
     IMEKLLSDIS FNAPDLKGQK IPITRQYIQE TLSDIIKDED LSRYIL                      466
//

If you have problems or comments...

PBIL Back to PBIL home page