(data stored in ACNUC7421 zone)

EMBL: CP000478.PE66

CP000478.PE66        Location/Qualifiers
FT   CDS             complement(83198..84184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0067"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   pca:Pcar_0623 site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15770"
FT                   /db_xref="GOA:A0LEB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB8"
FT                   /protein_id="ABK15770.1"
FT                   /translation="MAPGTLDDNSADGSEATWSEASARFIAHLRHERGLSAETVRAYAG
FT                   DLDQFREHMNATAGTADPRLSQVDADAIRGYLAALHKTRKKTSRARKLSTLRSFYHFLN
FT                   DRELVRENPAALVAYPKLGTKIPSFLGVDDVFHLLDSLNAGAARAGASWRRCRNWALFE
FT                   CMYSTGVRVSELAGMDESDVDFHEGMVRVLGKGSKERIVPVGGKALDAVKLYLRVLDSQ
FT                   FPEARRMGSALFRNARGRRLTTRSVHRLLRMELRRCGLWQHLSPHGLRHTFATHLLNSG
FT                   ADLRAIQEMLGHSNLSTTQRYTHVHVDQLMKVYDAAHPRSRRDRSGK"
     MAPGTLDDNS ADGSEATWSE ASARFIAHLR HERGLSAETV RAYAGDLDQF REHMNATAGT        60
     ADPRLSQVDA DAIRGYLAAL HKTRKKTSRA RKLSTLRSFY HFLNDRELVR ENPAALVAYP       120
     KLGTKIPSFL GVDDVFHLLD SLNAGAARAG ASWRRCRNWA LFECMYSTGV RVSELAGMDE       180
     SDVDFHEGMV RVLGKGSKER IVPVGGKALD AVKLYLRVLD SQFPEARRMG SALFRNARGR       240
     RLTTRSVHRL LRMELRRCGL WQHLSPHGLR HTFATHLLNS GADLRAIQEM LGHSNLSTTQ       300
     RYTHVHVDQL MKVYDAAHPR SRRDRSGK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page