(data stored in ACNUC7421 zone)

EMBL: CP000478.PE69

CP000478.PE69        Location/Qualifiers
FT   CDS             88040..88579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0070"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: sat:SYN_02931
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15773"
FT                   /db_xref="GOA:A0LEC1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC1"
FT                   /protein_id="ABK15773.1"
FT                   /translation="MESRTTKQAKREFLRTVAIITVSDRGARGEREDASGQALHDLLTR
FT                   HGFDVCYQTIVPDEAEVISQAIRECAVVKRVALVLTTGGTGVSPRDVTPEATRAVIERL
FT                   VPGMAEAMRAANLLKTPHAMLSRAVVGIRGATLVINLPGSPTGAVENLSVLLGALPHAL
FT                   DKIQGDMSDCARPAGG"
     MESRTTKQAK REFLRTVAII TVSDRGARGE REDASGQALH DLLTRHGFDV CYQTIVPDEA        60
     EVISQAIREC AVVKRVALVL TTGGTGVSPR DVTPEATRAV IERLVPGMAE AMRAANLLKT       120
     PHAMLSRAVV GIRGATLVIN LPGSPTGAVE NLSVLLGALP HALDKIQGDM SDCARPAGG        179
//

If you have problems or comments...

PBIL Back to PBIL home page