(data stored in ACNUC7421 zone)

EMBL: CP000478.PE71

CP000478.PE71        Location/Qualifiers
FT   CDS             complement(89274..89750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0072"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   mbo:Mb0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15775"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC3"
FT                   /protein_id="ABK15775.1"
FT                   /translation="MSERPSPEKRFVVDIMLGKVAKWLRILGFDARCLRVDSSAQVTRF
FT                   REEGRIIVTRRRQWCGSTGVFCLTSNDPSEQLKELIAAVPIRLEELRPLRRCILCNLDL
FT                   EVLPRDRVFGRVPDFVFETNECFHHCPGCGRIYWPGTHLVRMVERMRRELNWSG"
     MSERPSPEKR FVVDIMLGKV AKWLRILGFD ARCLRVDSSA QVTRFREEGR IIVTRRRQWC        60
     GSTGVFCLTS NDPSEQLKEL IAAVPIRLEE LRPLRRCILC NLDLEVLPRD RVFGRVPDFV       120
     FETNECFHHC PGCGRIYWPG THLVRMVERM RRELNWSG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page