(data stored in ACNUC7421 zone)

EMBL: CP000478.PE72

CP000478.PE72        Location/Qualifiers
FT   CDS             complement(89747..90532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15776"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC4"
FT                   /protein_id="ABK15776.1"
FT                   /translation="MKTSRFHAVLLGLIMLCCLSCGKPKPPEVLPRPVSFDENLGKLEA
FT                   RAAHWRSYQAKLRIRLEGAKGKMRFQAIVLAVLPDQLRLEAFNLVGQTVALFTMNNGKP
FT                   ALSIPSEKMIFTAERPETLIEYFFGMPLPAGVFAYDLAAVVPPEQLDKLSPRREAPGWK
FT                   ADFSPEGSDASFLWEFEDNPPALKSLAARDGLWDRRITYDPAVELEPQNAPRKLRLESA
FT                   QWRMEITVEQIMPTSGFDASVFVPPVQEGVRTVDLDSIK"
     MKTSRFHAVL LGLIMLCCLS CGKPKPPEVL PRPVSFDENL GKLEARAAHW RSYQAKLRIR        60
     LEGAKGKMRF QAIVLAVLPD QLRLEAFNLV GQTVALFTMN NGKPALSIPS EKMIFTAERP       120
     ETLIEYFFGM PLPAGVFAYD LAAVVPPEQL DKLSPRREAP GWKADFSPEG SDASFLWEFE       180
     DNPPALKSLA ARDGLWDRRI TYDPAVELEP QNAPRKLRLE SAQWRMEITV EQIMPTSGFD       240
     ASVFVPPVQE GVRTVDLDSI K                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page