(data stored in ACNUC7421 zone)

EMBL: CP000478.PE73

CP000478.PE73        Location/Qualifiers
FT   CDS             complement(90604..92307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0074"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sat:SYN_00192
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15777"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC5"
FT                   /protein_id="ABK15777.1"
FT                   /translation="MILRYLLIIAVLSVCSCTQLKPYAATSSTPKAPAARSESGSRADL
FT                   YFEYLLAQYYVSVKEIDKAIEAYHEALKKDPRSPMLLTELAALLIRQGKIEQALKLTED
FT                   ATSFDRTYEPAYMLLGQLYAGIGQNARAIDAYSRAIEINPSNEDAHLLLGALYAQEKKY
FT                   DEAMEAFDHLKALLPDNPVALYYKARVFLDMKLYKQAEKIYLDVLAIEPAFENASLDLA
FT                   YVYEVTERLKDAEQTYLQILSANPANVNARTRLGNLYMRQDRPAEALRHFSHLLKLNRK
FT                   DVESRLKVGIIHLQQKDYEEAIKDFTYLLKDEPQYDQALYYLASTYAEKQDFEQAIRNF
FT                   RLIARSSPLWPMAQTRLALIFSKQKDFQNGAAVLKEAIDAQPEVADLYLYLGIIYEEAK
FT                   QYEDGVAAVDRGLVKTPRDTDLLFRKGVILDKMSRRDDAIAVMKRILEIEPQNANALNY
FT                   IGYTYAEMGINLNEARQMIKAALATAPDDGYIMDSLAWVYYKLGQHKKALETILEALKR
FT                   VPQDPVIHEHLGDIYLSLGKKNEAIEAYEKALEYSHTEPEKIREKLDRLK"
     MILRYLLIIA VLSVCSCTQL KPYAATSSTP KAPAARSESG SRADLYFEYL LAQYYVSVKE        60
     IDKAIEAYHE ALKKDPRSPM LLTELAALLI RQGKIEQALK LTEDATSFDR TYEPAYMLLG       120
     QLYAGIGQNA RAIDAYSRAI EINPSNEDAH LLLGALYAQE KKYDEAMEAF DHLKALLPDN       180
     PVALYYKARV FLDMKLYKQA EKIYLDVLAI EPAFENASLD LAYVYEVTER LKDAEQTYLQ       240
     ILSANPANVN ARTRLGNLYM RQDRPAEALR HFSHLLKLNR KDVESRLKVG IIHLQQKDYE       300
     EAIKDFTYLL KDEPQYDQAL YYLASTYAEK QDFEQAIRNF RLIARSSPLW PMAQTRLALI       360
     FSKQKDFQNG AAVLKEAIDA QPEVADLYLY LGIIYEEAKQ YEDGVAAVDR GLVKTPRDTD       420
     LLFRKGVILD KMSRRDDAIA VMKRILEIEP QNANALNYIG YTYAEMGINL NEARQMIKAA       480
     LATAPDDGYI MDSLAWVYYK LGQHKKALET ILEALKRVPQ DPVIHEHLGD IYLSLGKKNE       540
     AIEAYEKALE YSHTEPEKIR EKLDRLK                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page