(data stored in ACNUC7421 zone)

EMBL: CP000478.PE74

CP000478.PE74        Location/Qualifiers
FT   CDS             92497..93741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0075"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   aae:aq_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15778"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC6"
FT                   /protein_id="ABK15778.1"
FT                   /translation="MTMEHPKLRYGLEALPMQHEGQNMILLRDRMGHSSDSLLLSPVVA
FT                   ELVIRMDGTNSFRDLQALFLRMTGEMLYTETLDEIVQKLDQNLFLENARFIDHVARQVA
FT                   RYRDDPVRRMRHAGQSYPSDAELLNRRLEGFFSAEDGGPGLPGAARDNRPVLGLVAPHI
FT                   DIQAGGRCFAHAYKAAADSVSPRTWIVLGTGHELVSNYFALTAKDFETPLGLVGHDEEC
FT                   CAHLVNSAKRDILAGEYNHVREHTVEFQAVFLAYVQPGAKIVPLLCSFSHEDLETDGEY
FT                   IDHFAGLLRDLVLTRSVGILASVDLAHIGPRYGDRFQPTDSTVKDHMASDRGLVESLRE
FT                   CDAEAFIRQIRLEGNRRKICGVAPLYVLAQALSGLAQGRLLDHAHVRVDPYGSFVTFAS
FT                   MIFHGTQASPGSDSE"
     MTMEHPKLRY GLEALPMQHE GQNMILLRDR MGHSSDSLLL SPVVAELVIR MDGTNSFRDL        60
     QALFLRMTGE MLYTETLDEI VQKLDQNLFL ENARFIDHVA RQVARYRDDP VRRMRHAGQS       120
     YPSDAELLNR RLEGFFSAED GGPGLPGAAR DNRPVLGLVA PHIDIQAGGR CFAHAYKAAA       180
     DSVSPRTWIV LGTGHELVSN YFALTAKDFE TPLGLVGHDE ECCAHLVNSA KRDILAGEYN       240
     HVREHTVEFQ AVFLAYVQPG AKIVPLLCSF SHEDLETDGE YIDHFAGLLR DLVLTRSVGI       300
     LASVDLAHIG PRYGDRFQPT DSTVKDHMAS DRGLVESLRE CDAEAFIRQI RLEGNRRKIC       360
     GVAPLYVLAQ ALSGLAQGRL LDHAHVRVDP YGSFVTFASM IFHGTQASPG SDSE             414
//

If you have problems or comments...

PBIL Back to PBIL home page