(data stored in ACNUC7421 zone)

EMBL: CP000478.PE79

CP000478.PE79        Location/Qualifiers
FT   CDS             98054..99481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0080"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; KEGG:
FT                   bat:BAS3036 iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15783"
FT                   /db_xref="GOA:A0LED1"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED1"
FT                   /protein_id="ABK15783.1"
FT                   /translation="MTRIRTELFRQEAGKALNNRHLQEALSDFQERISKATATAFSSLS
FT                   DAEGLRLEARRARMRAIENLDVLLDRLADKILNRGGRVFFARDAREAVEYCLETARRLG
FT                   VKKVVKGKSMVAEEIGLNEALQEADIQVCETDVGEFIVQLAGEPPSHIIAPAVHKTKVE
FT                   VGRLFSEKLGIPYTDDPVALTRAARNALRQRFLEADMGISGCNLACAETGHITTVSNEG
FT                   NIRMASTLPRVHIAIMGMERIAARLEDHDVLLRLLCMGAAGQRLAGYVSYLGGPRQPDQ
FT                   EDGPDEFHLVVLDNGRSRILADEDFREILCCIRCAACLNVCPVYGKIGGHAYGHVYCGP
FT                   VGSVLTPLLVGVNRAKDLCLGETLCGACRDACPLHIDIPGMLLRLRSKLADGDDGWGVK
FT                   RERPAEKLFFTLWAGLVRSPGLYALALTAAAFLQRLPPGAKDTITRLPYPFHEWTQSRD
FT                   IKRLDGRAFRKRWKELR"
     MTRIRTELFR QEAGKALNNR HLQEALSDFQ ERISKATATA FSSLSDAEGL RLEARRARMR        60
     AIENLDVLLD RLADKILNRG GRVFFARDAR EAVEYCLETA RRLGVKKVVK GKSMVAEEIG       120
     LNEALQEADI QVCETDVGEF IVQLAGEPPS HIIAPAVHKT KVEVGRLFSE KLGIPYTDDP       180
     VALTRAARNA LRQRFLEADM GISGCNLACA ETGHITTVSN EGNIRMASTL PRVHIAIMGM       240
     ERIAARLEDH DVLLRLLCMG AAGQRLAGYV SYLGGPRQPD QEDGPDEFHL VVLDNGRSRI       300
     LADEDFREIL CCIRCAACLN VCPVYGKIGG HAYGHVYCGP VGSVLTPLLV GVNRAKDLCL       360
     GETLCGACRD ACPLHIDIPG MLLRLRSKLA DGDDGWGVKR ERPAEKLFFT LWAGLVRSPG       420
     LYALALTAAA FLQRLPPGAK DTITRLPYPF HEWTQSRDIK RLDGRAFRKR WKELR            475
//

If you have problems or comments...

PBIL Back to PBIL home page