(data stored in ACNUC7421 zone)

EMBL: CP000478.PE8

CP000478.PE8         Location/Qualifiers
FT   CDS             complement(9364..12606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0008"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; KEGG: sat:SYN_01625
FT                   carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15712"
FT                   /db_xref="GOA:A0LE60"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE60"
FT                   /protein_id="ABK15712.1"
FT                   /translation="MPKRTDIRKILIIGSGPIIISQACEFDYSGTQACKALREEGYEIV
FT                   LINSNPATIMTDPETADRTYIEPITPEAVAKVIERERPDALLPTLGGQTALNVAVRVAE
FT                   TGVLERFGVALIGASVEVIKKAEDRELFRDAMKRIGLRVPASGIARSMSEVESIAREIG
FT                   FPIIVRPSFTLGGTGGGVAYNREELKELAQSGLDASFIHTVMLEESVLGWKEFELEVMR
FT                   DCMDNVVIICSIENMDAMGVHTGDSITVAPAQTLTDREYQLLRDASIAILREIGVETGG
FT                   SNVQFAINPADGEMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYSLDEIANDIT
FT                   RETRASFEPTIDYCVVKVPRFTFEKFPRTEDFLSTSMKSVGETMAIGRTFKEALHKAVR
FT                   SLEIGRFGFVDPPANADREYMERLRQKLRRPNSMRLFQIGEALKLGMPIEELHALTFID
FT                   PWFLHHIRQVLLLEDEIRGDADRSGFLDDPERVRYAKSWGFSDVRLAQLSGSDEETVRQ
FT                   LRIKHGIKPVYKLVDTCAAEFEAYTPYYYSTYETEDEARPTGRPKVVILGGGPNRIGQG
FT                   IEFDYCCVHASFSLREEDHESIMVNSNPETVSTDYDTSDKLYFEPLTREDVLHILDTEK
FT                   PKGVIVQFGGQTPLNLSVPLEKAGARILGTSPDAIDRAEDRKRFQKLLQKLGLKQPRNA
FT                   TAFTLREAAEAAGRIGYPVVVRPSYVLGGRAMEIVFDAAMLESFMKTAVHVSPGHPILI
FT                   DQFLEDAVEIDVDAISDGTVTVVGGIMEHIEQAGIHSGDSACVLPPMSISRSIQEEIRR
FT                   QTRLLAKELGVVGLMNIQFALQNGEIFILEVNPRASRTIPFVSKAIGFPLAKLATRVML
FT                   GKSLKELGFDTEVEPEHISVKEAVFPFSRFPNVDVLLGPEMKSTGEVMGIGSTFGIAFA
FT                   KAQAAVGYELPTSGTVFISVHDADKPKVLSVARKFGEMGFQLIATAGTADFLNGNGIRT
FT                   RPVFKLKEGRPHVVDRIKNGEVQLVVNTSMGKKTTSDSYEIRRTTLIYNIPYATTIAGA
FT                   KAMAEAVSELQRGDWDVRTLQEYHHRERSRRQ"
     MPKRTDIRKI LIIGSGPIII SQACEFDYSG TQACKALREE GYEIVLINSN PATIMTDPET        60
     ADRTYIEPIT PEAVAKVIER ERPDALLPTL GGQTALNVAV RVAETGVLER FGVALIGASV       120
     EVIKKAEDRE LFRDAMKRIG LRVPASGIAR SMSEVESIAR EIGFPIIVRP SFTLGGTGGG       180
     VAYNREELKE LAQSGLDASF IHTVMLEESV LGWKEFELEV MRDCMDNVVI ICSIENMDAM       240
     GVHTGDSITV APAQTLTDRE YQLLRDASIA ILREIGVETG GSNVQFAINP ADGEMVVIEM       300
     NPRVSRSSAL ASKATGFPIA KIAAKLAVGY SLDEIANDIT RETRASFEPT IDYCVVKVPR       360
     FTFEKFPRTE DFLSTSMKSV GETMAIGRTF KEALHKAVRS LEIGRFGFVD PPANADREYM       420
     ERLRQKLRRP NSMRLFQIGE ALKLGMPIEE LHALTFIDPW FLHHIRQVLL LEDEIRGDAD       480
     RSGFLDDPER VRYAKSWGFS DVRLAQLSGS DEETVRQLRI KHGIKPVYKL VDTCAAEFEA       540
     YTPYYYSTYE TEDEARPTGR PKVVILGGGP NRIGQGIEFD YCCVHASFSL REEDHESIMV       600
     NSNPETVSTD YDTSDKLYFE PLTREDVLHI LDTEKPKGVI VQFGGQTPLN LSVPLEKAGA       660
     RILGTSPDAI DRAEDRKRFQ KLLQKLGLKQ PRNATAFTLR EAAEAAGRIG YPVVVRPSYV       720
     LGGRAMEIVF DAAMLESFMK TAVHVSPGHP ILIDQFLEDA VEIDVDAISD GTVTVVGGIM       780
     EHIEQAGIHS GDSACVLPPM SISRSIQEEI RRQTRLLAKE LGVVGLMNIQ FALQNGEIFI       840
     LEVNPRASRT IPFVSKAIGF PLAKLATRVM LGKSLKELGF DTEVEPEHIS VKEAVFPFSR       900
     FPNVDVLLGP EMKSTGEVMG IGSTFGIAFA KAQAAVGYEL PTSGTVFISV HDADKPKVLS       960
     VARKFGEMGF QLIATAGTAD FLNGNGIRTR PVFKLKEGRP HVVDRIKNGE VQLVVNTSMG      1020
     KKTTSDSYEI RRTTLIYNIP YATTIAGAKA MAEAVSELQR GDWDVRTLQE YHHRERSRRQ      1080
//

If you have problems or comments...

PBIL Back to PBIL home page