(data stored in ACNUC7421 zone)

EMBL: CP000478.PE80

CP000478.PE80        Location/Qualifiers
FT   CDS             99875..100303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0081"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162; KEGG:
FT                   dvu:DVU1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15784"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED2"
FT                   /protein_id="ABK15784.1"
FT                   /translation="MFTAGLCAPGLEGMPAEESLEHIRKNVVESCIGVTAADYCVADTA
FT                   TLVMKTRPGQPRMLSLVPSVHIAVITLDQILADLRELYAFLRWEAREREDEGLTNCLTM
FT                   VTGPSKTADIELSMVHGAHGPRELHIVVIIGPAASTAN"
     MFTAGLCAPG LEGMPAEESL EHIRKNVVES CIGVTAADYC VADTATLVMK TRPGQPRMLS        60
     LVPSVHIAVI TLDQILADLR ELYAFLRWEA REREDEGLTN CLTMVTGPSK TADIELSMVH       120
     GAHGPRELHI VVIIGPAAST AN                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page