(data stored in ACNUC7421 zone)

EMBL: CP000478.PE81

CP000478.PE81        Location/Qualifiers
FT   CDS             complement(100272..100793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED3"
FT                   /protein_id="ABK15785.1"
FT                   /translation="MRYRQAAVELDDTSFRSTGHRSHAAVRIREKRRIERAARASAFTR
FT                   TLRFALVSPRLRNGRDCLYSRAQKTIPDGFTLAGTEMKTSFEDGERGARNPGTGMDPVF
FT                   GSSAPTKCRVPVDIPSELHGPLFYPLSRTERPSGRGRREPRAWSLPAKARDVFREARRA
FT                   LSSLLKQRGR"
     MRYRQAAVEL DDTSFRSTGH RSHAAVRIRE KRRIERAARA SAFTRTLRFA LVSPRLRNGR        60
     DCLYSRAQKT IPDGFTLAGT EMKTSFEDGE RGARNPGTGM DPVFGSSAPT KCRVPVDIPS       120
     ELHGPLFYPL SRTERPSGRG RREPRAWSLP AKARDVFREA RRALSSLLKQ RGR              173
//

If you have problems or comments...

PBIL Back to PBIL home page