(data stored in ACNUC7421 zone)

EMBL: CP000478.PE83

CP000478.PE83        Location/Qualifiers
FT   CDS             101883..102251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0084"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; KEGG:
FT                   rba:RB10458 RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15787"
FT                   /db_xref="GOA:A0LED5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED5"
FT                   /protein_id="ABK15787.1"
FT                   /translation="MSMKLYVGNLSFQTSSEQLRELFSQVGTVESATVVEDRESGRSRG
FT                   FGFVEMSTKEEGQKAIAELNGKDFNGRPLTVNEAKQREDRGRGGPRGGSGGGRGGYGGG
FT                   GGRGGGFGGGGGGRKKGW"
     MSMKLYVGNL SFQTSSEQLR ELFSQVGTVE SATVVEDRES GRSRGFGFVE MSTKEEGQKA        60
     IAELNGKDFN GRPLTVNEAK QREDRGRGGP RGGSGGGRGG YGGGGGRGGG FGGGGGGRKK       120
     GW                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page