(data stored in ACNUC7421 zone)

EMBL: CP000478.PE86

CP000478.PE86        Location/Qualifiers
FT   CDS             106093..107361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15790"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED8"
FT                   /protein_id="ABK15790.1"
FT                   /translation="MKAREPDTIAGIPLTPESGLILRCVRHYSGRDERTRIARQLQGRL
FT                   DWDALLRLAEAHKILPILHAVLKESHWREVPESVLETMKRKHAANFAGNLLLSYELIRI
FT                   LEALGSRGIRCLVFKGPTLAVAAYGSIAMRRFQDLDLLVRRNDFLKTKDLLREIGYQPA
FT                   LRLPEAYEKHFYLTRSEHHFVRNDGKATVDLHWGLSPPCFSFFQDLDRLWPRSVTVAIE
FT                   GATVRAPGMEDLLLFLCRHGAKHRWEGLSLISDVAVLIAAHRAMDWPGVLARAKRTNST
FT                   VMLALGLRLAAELAGAEVPENIGDWMRADRKGEVLAGKVIRSLFSSEERPTVDVADRLN
FT                   LFHMRTMSRFTDRLHEIVLNLFTPTSIELSLIRLPARLYFLYYPCRLLRLAVRSVLNKA
FT                   LRTPRRQTPDRTGARRTSGSDKP"
     MKAREPDTIA GIPLTPESGL ILRCVRHYSG RDERTRIARQ LQGRLDWDAL LRLAEAHKIL        60
     PILHAVLKES HWREVPESVL ETMKRKHAAN FAGNLLLSYE LIRILEALGS RGIRCLVFKG       120
     PTLAVAAYGS IAMRRFQDLD LLVRRNDFLK TKDLLREIGY QPALRLPEAY EKHFYLTRSE       180
     HHFVRNDGKA TVDLHWGLSP PCFSFFQDLD RLWPRSVTVA IEGATVRAPG MEDLLLFLCR       240
     HGAKHRWEGL SLISDVAVLI AAHRAMDWPG VLARAKRTNS TVMLALGLRL AAELAGAEVP       300
     ENIGDWMRAD RKGEVLAGKV IRSLFSSEER PTVDVADRLN LFHMRTMSRF TDRLHEIVLN       360
     LFTPTSIELS LIRLPARLYF LYYPCRLLRL AVRSVLNKAL RTPRRQTPDR TGARRTSGSD       420
     KP                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page