(data stored in ACNUC7421 zone)

EMBL: CP000478.PE88

CP000478.PE88        Location/Qualifiers
FT   CDS             complement(109721..110014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15792"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE0"
FT                   /protein_id="ABK15792.1"
FT                   /translation="MNNARQRQKRRNRNRRVRKIAVRSWSALLKRAPGKGLRPTGKDRP
FT                   VEELKDDGCRVGLRAGPDRLPSHLGILLGYEKTRDIDHPGFFMRPELRPMFQ"
     MNNARQRQKR RNRNRRVRKI AVRSWSALLK RAPGKGLRPT GKDRPVEELK DDGCRVGLRA        60
     GPDRLPSHLG ILLGYEKTRD IDHPGFFMRP ELRPMFQ                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page