(data stored in ACNUC7421 zone)

EMBL: CP000478.PE9

CP000478.PE9         Location/Qualifiers
FT   CDS             complement(13077..14252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0009"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain; KEGG:
FT                   sat:SYN_01627 carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15713"
FT                   /db_xref="GOA:A0LE61"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE61"
FT                   /protein_id="ABK15713.1"
FT                   /translation="MTSPWKRNSALLLLEDGTVFRGYAFAGGGRALGEVVFNTSMTGYQ
FT                   EVLTDPSYKGQMVTMTYPLTGAYGINDEDMESAAVQVEAFIVKEYQEFPSNWRSNRSLA
FT                   DFLNEYNKIGIEGIDTRALTRHIRMGGAMRGIIATDTDNVKELMEEVQAYPGLNGIDLV
FT                   KTVTCSKPYLWRTGVKPGTLEPKWPENRPELRVAAIDCGVKYNILRKLEASGCQVMVFP
FT                   AHVSAREIAACKPDGVFLSNGPGDPSAVGYVIETVRSLLGEKPVFGICLGHQMMGLALG
FT                   GRTFKLKFGHRGGNQPVKDVTTGKVEITSQNHGYCVDIDSLGNVPVKLTHVNLNDNTLE
FT                   GMEHLEIPAFSVQYHPEASPGPHDASYLFDRFVRLMQGPERGHGASAPRGR"
     MTSPWKRNSA LLLLEDGTVF RGYAFAGGGR ALGEVVFNTS MTGYQEVLTD PSYKGQMVTM        60
     TYPLTGAYGI NDEDMESAAV QVEAFIVKEY QEFPSNWRSN RSLADFLNEY NKIGIEGIDT       120
     RALTRHIRMG GAMRGIIATD TDNVKELMEE VQAYPGLNGI DLVKTVTCSK PYLWRTGVKP       180
     GTLEPKWPEN RPELRVAAID CGVKYNILRK LEASGCQVMV FPAHVSAREI AACKPDGVFL       240
     SNGPGDPSAV GYVIETVRSL LGEKPVFGIC LGHQMMGLAL GGRTFKLKFG HRGGNQPVKD       300
     VTTGKVEITS QNHGYCVDID SLGNVPVKLT HVNLNDNTLE GMEHLEIPAF SVQYHPEASP       360
     GPHDASYLFD RFVRLMQGPE RGHGASAPRG R                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page