(data stored in ACNUC7421 zone)

EMBL: CP000478.PE90

CP000478.PE90        Location/Qualifiers
FT   CDS             111908..112576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0091"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: dvu:DVU3145
FT                   hydrogenase, b-type cytochrome subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15794"
FT                   /db_xref="GOA:A0LEE2"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE2"
FT                   /protein_id="ABK15794.1"
FT                   /translation="MTQTEMVNVYLYTRYERFWHWLQTTLIVLLLMTGFEINGLFRLFG
FT                   FKLATEIHEYAGLSWLIAFAFFVFWLFTTGEWRQYIPTTRKMLTVIRYYTYGIFRGEAH
FT                   PVPKRKDAKHNPLQRLVYLSLAAILLPIQMITGFLYWGYNSWPDWGLNWLSLEVVASIH
FT                   LAGAFGVLSFLIVHLYMITTGHTLFAHTRAMITGWEQVAEGTPIDDWERKDRGKSAECS
FT                   "
     MTQTEMVNVY LYTRYERFWH WLQTTLIVLL LMTGFEINGL FRLFGFKLAT EIHEYAGLSW        60
     LIAFAFFVFW LFTTGEWRQY IPTTRKMLTV IRYYTYGIFR GEAHPVPKRK DAKHNPLQRL       120
     VYLSLAAILL PIQMITGFLY WGYNSWPDWG LNWLSLEVVA SIHLAGAFGV LSFLIVHLYM       180
     ITTGHTLFAH TRAMITGWEQ VAEGTPIDDW ERKDRGKSAE CS                          222
//

If you have problems or comments...

PBIL Back to PBIL home page