(data stored in ACNUC7421 zone)

EMBL: CP000478.PE93

CP000478.PE93        Location/Qualifiers
FT   CDS             complement(114367..115656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dvu:DVUA0096 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15797"
FT                   /db_xref="GOA:A0LEE5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE5"
FT                   /protein_id="ABK15797.1"
FT                   /translation="MDVEPATESKTMNPFSQLFGLCAVGFFARLSYALARSPVLPLFAL
FT                   YLGAAPEIIGWVVGISTVTGIFFKLPSGALSDVIGRRKTMLVGLVVFALTPFAYFWVKD
FT                   AALLLIVRFVHGFATAVYGPVAMAVVADVAGCRKGEMLSWFSSVTIAGSLLGAPLGGFL
FT                   LFTLARSGSPSLEHFHWVYLASGAFGCVALILGGKLLAGGDETVTQVGLKASLAQFGAG
FT                   IREVVSDRRVVLTSSMEGLQNMTMGALEAFLPIYAVKVAGLNEFQAGLLWGAQVLVTIV
FT                   SKPLMGRLSDRYGRKPAIVIGMLACAVAFAAIPLLTRFELLILASLLFGLGEAFVTSSS
FT                   AALVADLCQERHFGTAMGTFGTIFDVGHASGPILAGVLIASWGYLPAFSIMSAALVVAL
FT                   PVFILGVKVESRTSMVTSRVWRRRHRKGLP"
     MDVEPATESK TMNPFSQLFG LCAVGFFARL SYALARSPVL PLFALYLGAA PEIIGWVVGI        60
     STVTGIFFKL PSGALSDVIG RRKTMLVGLV VFALTPFAYF WVKDAALLLI VRFVHGFATA       120
     VYGPVAMAVV ADVAGCRKGE MLSWFSSVTI AGSLLGAPLG GFLLFTLARS GSPSLEHFHW       180
     VYLASGAFGC VALILGGKLL AGGDETVTQV GLKASLAQFG AGIREVVSDR RVVLTSSMEG       240
     LQNMTMGALE AFLPIYAVKV AGLNEFQAGL LWGAQVLVTI VSKPLMGRLS DRYGRKPAIV       300
     IGMLACAVAF AAIPLLTRFE LLILASLLFG LGEAFVTSSS AALVADLCQE RHFGTAMGTF       360
     GTIFDVGHAS GPILAGVLIA SWGYLPAFSI MSAALVVALP VFILGVKVES RTSMVTSRVW       420
     RRRHRKGLP                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page