(data stored in ACNUC7421 zone)

EMBL: CP000478.PE94

CP000478.PE94        Location/Qualifiers
FT   CDS             complement(115679..116020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15798"
FT                   /db_xref="GOA:A0LEE6"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR019224"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE6"
FT                   /protein_id="ABK15798.1"
FT                   /translation="MVGLKKFQAAGCHCGACGFPTCAELNKERQPGEKDREYTGPHCVM
FT                   RMMDIGAALASAAKTVVLLNIDNRVRQRFGAVARALGLIDAEMVMGVQVSITGKIIGYD
FT                   GKVPAVKGR"
     MVGLKKFQAA GCHCGACGFP TCAELNKERQ PGEKDREYTG PHCVMRMMDI GAALASAAKT        60
     VVLLNIDNRV RQRFGAVARA LGLIDAEMVM GVQVSITGKI IGYDGKVPAV KGR              113
//

If you have problems or comments...

PBIL Back to PBIL home page