(data stored in ACNUC7421 zone)

EMBL: CP000478.PE99

CP000478.PE99        Location/Qualifiers
FT   CDS             complement(122508..123116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0100"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: mca:MCA0242 ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; TIGRFAM: ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14,
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15803"
FT                   /db_xref="GOA:A0LEF1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEF1"
FT                   /protein_id="ABK15803.1"
FT                   /translation="MSLIPIVVEQSSRGERAFDIYSRLLRDRIIFLGTAITDEVANVII
FT                   AQLLFLESEDPDKDIHFYINSPGGLVTAGLAIYDTMQFIKPNVSTLCMGQAASMAAILL
FT                   AAGVKGKRYALPHVRIMLHQPMGGFQGQATDVEIQAKEILKLREELNDILVRHTGRPVE
FT                   QIQRDTDRDFYMSGEQAREYGMVDHIFTSRLSILPSATS"
     MSLIPIVVEQ SSRGERAFDI YSRLLRDRII FLGTAITDEV ANVIIAQLLF LESEDPDKDI        60
     HFYINSPGGL VTAGLAIYDT MQFIKPNVST LCMGQAASMA AILLAAGVKG KRYALPHVRI       120
     MLHQPMGGFQ GQATDVEIQA KEILKLREEL NDILVRHTGR PVEQIQRDTD RDFYMSGEQA       180
     REYGMVDHIF TSRLSILPSA TS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page