(data stored in ACNUC7421 zone)

EMBL: CP000489.PE1

CP000489.PE1         Location/Qualifiers
FT   CDS             170..616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0001"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   sil:SPO3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68118"
FT                   /db_xref="GOA:A1AXX4"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXX4"
FT                   /protein_id="ABL68118.1"
FT                   /translation="MTDFLPLAYPWIKALHVMAVLSWMAGLFYLPRLFVYHAERGHLGQ
FT                   EPVQSFRIMEDKLLRLIMNPAMIVTWIAGLALVLTPGIVDWTMIWPWTKAAGVLGMTWF
FT                   HMWLAGQRKALLLGQGLSGRRYRMMNEVPTLLMVLIVLSVIVKF"
     MTDFLPLAYP WIKALHVMAV LSWMAGLFYL PRLFVYHAER GHLGQEPVQS FRIMEDKLLR        60
     LIMNPAMIVT WIAGLALVLT PGIVDWTMIW PWTKAAGVLG MTWFHMWLAG QRKALLLGQG       120
     LSGRRYRMMN EVPTLLMVLI VLSVIVKF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page