(data stored in ACNUC7421 zone)

EMBL: CP000489.PE100

CP000489.PE100       Location/Qualifiers
FT   CDS             91189..94185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0100"
FT                   /product="plasmid mobilization system relaxase"
FT                   /note="PFAM: MobA/MobL protein; KEGG: rpc:RPC_0149
FT                   MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68217"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY73"
FT                   /protein_id="ABL68217.1"
FT                   /translation="MAIYHLHVKVIGRKAGSSAVASAAYRSASRMRDERIDRVQDFSAK
FT                   RGVVHSEVMLPDNAPEHLGDRERLWNDVEAFEVRKDAQLAREVEFAIPREMTQAQGIEL
FT                   ARDFAQAEFVDQGMIADLNVHWDIGEDGMPKPHAHVMLTMRSVDENGFGQKVRDWNRTE
FT                   MVERWRERWAEHVNERLAELDIDARIDHRSLEAQGIGLEPQSQIGAPAQRIEGEGIEAA
FT                   DRADMHREIARNNGARIIADPSVALDAITHQQSTFTRRDMAKFAHRHSDGIDQFNEVMG
FT                   AMRNAPDLVELGKDGRGEDRFTTRDMIEAEQRLHRAAEMMAGKGRHEVSDWNREAALAR
FT                   AEQRGLVLSGEQADALAHVTDGRDLGIVVGYAGTGKSAMLGVAREAWEAAGYEVRGVAL
FT                   SGIAAENLEGGSGIASRTIASMEHGWKNGRDMLTSRDVLVIDEAGMVGTRQLERVLSHA
FT                   QEAGAKVVLVGDPQQLQSIEAGAAFRSIHERHGGAEIGEVRRQREDWQRDATRDLATGR
FT                   TGDAISAYDRNGMVHSADTREQARGDLIDRWDGQRQHNPDSSRIILTHTNAEVRELNEA
FT                   ARDRMRAAGDLGEDVRLTVERGERSFAAGDRVMFLQNERGLGVKNGTLGTIEDVSPQSM
FT                   SVRTDDGRSISFDLKDYDRIDHGYAATIHKAQGMTVDRTHVLATPGMDAHGSYVALSRH
FT                   RDGMDLHYGRDDFASQDRLINTLSRDRAKDMATDYEQQIDPAQDYAERRGITFRARVAQ
FT                   IMRRLMPERVRDAIDDYIDSLRAPGEHVPAGPDREAARREVQRDLEVTSRKTGIEPEEL
FT                   LRRASSGQAFVRHARAVDAIFAAQDLGVAATPGQVQELHEARAGFDQHYPHGSRDAEAV
FT                   YKRNPGFAADVASGDPDRAAPARRALQLETGMRRNPGLRADRFVERFREVRQASESRYA
FT                   AGDYSGYHAARAEMGNMAMSLERDPQMESLLETRKKQLGIGMDFDSGMRLGRQLALSHG
FT                   LGRGRSIGL"
     MAIYHLHVKV IGRKAGSSAV ASAAYRSASR MRDERIDRVQ DFSAKRGVVH SEVMLPDNAP        60
     EHLGDRERLW NDVEAFEVRK DAQLAREVEF AIPREMTQAQ GIELARDFAQ AEFVDQGMIA       120
     DLNVHWDIGE DGMPKPHAHV MLTMRSVDEN GFGQKVRDWN RTEMVERWRE RWAEHVNERL       180
     AELDIDARID HRSLEAQGIG LEPQSQIGAP AQRIEGEGIE AADRADMHRE IARNNGARII       240
     ADPSVALDAI THQQSTFTRR DMAKFAHRHS DGIDQFNEVM GAMRNAPDLV ELGKDGRGED       300
     RFTTRDMIEA EQRLHRAAEM MAGKGRHEVS DWNREAALAR AEQRGLVLSG EQADALAHVT       360
     DGRDLGIVVG YAGTGKSAML GVAREAWEAA GYEVRGVALS GIAAENLEGG SGIASRTIAS       420
     MEHGWKNGRD MLTSRDVLVI DEAGMVGTRQ LERVLSHAQE AGAKVVLVGD PQQLQSIEAG       480
     AAFRSIHERH GGAEIGEVRR QREDWQRDAT RDLATGRTGD AISAYDRNGM VHSADTREQA       540
     RGDLIDRWDG QRQHNPDSSR IILTHTNAEV RELNEAARDR MRAAGDLGED VRLTVERGER       600
     SFAAGDRVMF LQNERGLGVK NGTLGTIEDV SPQSMSVRTD DGRSISFDLK DYDRIDHGYA       660
     ATIHKAQGMT VDRTHVLATP GMDAHGSYVA LSRHRDGMDL HYGRDDFASQ DRLINTLSRD       720
     RAKDMATDYE QQIDPAQDYA ERRGITFRAR VAQIMRRLMP ERVRDAIDDY IDSLRAPGEH       780
     VPAGPDREAA RREVQRDLEV TSRKTGIEPE ELLRRASSGQ AFVRHARAVD AIFAAQDLGV       840
     AATPGQVQEL HEARAGFDQH YPHGSRDAEA VYKRNPGFAA DVASGDPDRA APARRALQLE       900
     TGMRRNPGLR ADRFVERFRE VRQASESRYA AGDYSGYHAA RAEMGNMAMS LERDPQMESL       960
     LETRKKQLGI GMDFDSGMRL GRQLALSHGL GRGRSIGL                               998
//

If you have problems or comments...

PBIL Back to PBIL home page