(data stored in ACNUC7421 zone)

EMBL: CP000489.PE103

CP000489.PE103       Location/Qualifiers
FT   CDS             95326..95817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0103"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: rru:Rru_A1415 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68220"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY76"
FT                   /protein_id="ABL68220.1"
FT                   /translation="MSLSRERSQTGILTSYEMSVYGLSMRLVLDTNVIVAAFRSRNGAS
FT                   NLLLRAVDRGVLTPLCSTALFLEYEAVLSREETRKATGHSLEDVTGVMSALAAVSEGVD
FT                   ISFRTRPMLSDVADEMVLEAALNGQAEAIVTHNVKDFRPALTLGVTIATPGEIVRRLNT
FT                   "
     MSLSRERSQT GILTSYEMSV YGLSMRLVLD TNVIVAAFRS RNGASNLLLR AVDRGVLTPL        60
     CSTALFLEYE AVLSREETRK ATGHSLEDVT GVMSALAAVS EGVDISFRTR PMLSDVADEM       120
     VLEAALNGQA EAIVTHNVKD FRPALTLGVT IATPGEIVRR LNT                         163
//

If you have problems or comments...

PBIL Back to PBIL home page