(data stored in ACNUC7421 zone)

EMBL: CP000489.PE105

CP000489.PE105       Location/Qualifiers
FT   CDS             96094..97743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0105"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nwi:Nwi_2841 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68222"
FT                   /db_xref="GOA:A1AY78"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY78"
FT                   /protein_id="ABL68222.1"
FT                   /translation="MTRAALYARYSDDKQNEASIEDQFRLCREHAGRERWQIVGSYEDA
FT                   AISGASTILRPGIQRLMRDAQHGEFSILLAEALDRISRDQADVATLFKQLKFAGVTIVT
FT                   LAEGEITELHVGLKGTMNALFLKDLAMKTHRGLRGRVEKGKSGGGLCYGYKVVKKLDGN
FT                   GEPIRGDREIIPEEADTVRRIFREFASGKSPKAIAVDLNRDGVPGPLGRAWGDTSIRGH
FT                   RNRGTGIVNNELYAGVLVWNRLRFVKDPSTGKRVSRPNPESAWIRTEVPHLRIVDDALW
FT                   NAVRERQKQIAEIFGPNLANTREDRMKRLHLANRPVSLLSGLMTCGCCGGKIGIILSDR
FT                   LGCLNHHRRGTCTNNRTILRDKLEARVLTGLQERLVSAEAVKEAVRAYVEETNRLNQQR
FT                   RTQQETDRRALAKIERAIAGIIAAIEDGMYQPSMKARMDELERQKAEIVARMAEAPADM
FT                   PDVHPNVAANYSRNVARFAEALRDPDGGREAAEALRSLIGGIIVTPGEKRGEVHAELRG
FT                   ELMGILGIAAVQPEQGRTSVMSPVAAGPRNQR"
     MTRAALYARY SDDKQNEASI EDQFRLCREH AGRERWQIVG SYEDAAISGA STILRPGIQR        60
     LMRDAQHGEF SILLAEALDR ISRDQADVAT LFKQLKFAGV TIVTLAEGEI TELHVGLKGT       120
     MNALFLKDLA MKTHRGLRGR VEKGKSGGGL CYGYKVVKKL DGNGEPIRGD REIIPEEADT       180
     VRRIFREFAS GKSPKAIAVD LNRDGVPGPL GRAWGDTSIR GHRNRGTGIV NNELYAGVLV       240
     WNRLRFVKDP STGKRVSRPN PESAWIRTEV PHLRIVDDAL WNAVRERQKQ IAEIFGPNLA       300
     NTREDRMKRL HLANRPVSLL SGLMTCGCCG GKIGIILSDR LGCLNHHRRG TCTNNRTILR       360
     DKLEARVLTG LQERLVSAEA VKEAVRAYVE ETNRLNQQRR TQQETDRRAL AKIERAIAGI       420
     IAAIEDGMYQ PSMKARMDEL ERQKAEIVAR MAEAPADMPD VHPNVAANYS RNVARFAEAL       480
     RDPDGGREAA EALRSLIGGI IVTPGEKRGE VHAELRGELM GILGIAAVQP EQGRTSVMSP       540
     VAAGPRNQR                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page