(data stored in ACNUC7421 zone)

EMBL: CP000489.PE106

CP000489.PE106       Location/Qualifiers
FT   CDS             complement(97636..99429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0106"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nha:Nham_3864 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68223"
FT                   /db_xref="GOA:A1AY79"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY79"
FT                   /protein_id="ABL68223.1"
FT                   /translation="MRVAIYARYSSDQQREASIADQFRMCRLRAEKEGWTVVEEYSDHA
FT                   ISGSSMIQRPGIQALILDSSRGRFDMVLAEALDRISRDQEDIAGIYKRMCYADIKMFTL
FT                   SEGEITQLHVGLKGTMNALFLKDLADKTRRGLRGRVEDGKSGGGNSYGYDVVKRFDGNG
FT                   EPIRGDRTINEAQAAVIRRIFADYDSGLSSRTIAMTLNREGVPGPMGREWGPSTIHGNR
FT                   ERGTGILNNELYVGRLVWNRLRYVKDPDTGRRVSRLNPESEWVTQDVPDLRIVDQALWD
FT                   AVKARQGELAFSTRSRPEGNPLNDRRRPKHLFAGLVKCGCCGGGYSMISKDLLGCSTAR
FT                   NKGTCDNRVNIRRDALEASVLNGLKKHLMEPELFREFCTEFTREVNRLRMERGADLEVA
FT                   RRDLDRTTRELDKAIDAILQGVPPLTLKDKITQLEARKAELTEKLANADEPPPLLHPNM
FT                   AALYAQRIAKLSENLQQEDSRAQAAEILRSLVEQVTLVPEDGELAIVLRGDLGAILRFA
FT                   AGRKNPDFLSEAEALDNLLAQSGGSRKPWRGQQKTSSAVALEVSQLSLVAGACGHWRHN
FT                   RCSPLFRLDGGDTENAHQLAA"
     MRVAIYARYS SDQQREASIA DQFRMCRLRA EKEGWTVVEE YSDHAISGSS MIQRPGIQAL        60
     ILDSSRGRFD MVLAEALDRI SRDQEDIAGI YKRMCYADIK MFTLSEGEIT QLHVGLKGTM       120
     NALFLKDLAD KTRRGLRGRV EDGKSGGGNS YGYDVVKRFD GNGEPIRGDR TINEAQAAVI       180
     RRIFADYDSG LSSRTIAMTL NREGVPGPMG REWGPSTIHG NRERGTGILN NELYVGRLVW       240
     NRLRYVKDPD TGRRVSRLNP ESEWVTQDVP DLRIVDQALW DAVKARQGEL AFSTRSRPEG       300
     NPLNDRRRPK HLFAGLVKCG CCGGGYSMIS KDLLGCSTAR NKGTCDNRVN IRRDALEASV       360
     LNGLKKHLME PELFREFCTE FTREVNRLRM ERGADLEVAR RDLDRTTREL DKAIDAILQG       420
     VPPLTLKDKI TQLEARKAEL TEKLANADEP PPLLHPNMAA LYAQRIAKLS ENLQQEDSRA       480
     QAAEILRSLV EQVTLVPEDG ELAIVLRGDL GAILRFAAGR KNPDFLSEAE ALDNLLAQSG       540
     GSRKPWRGQQ KTSSAVALEV SQLSLVAGAC GHWRHNRCSP LFRLDGGDTE NAHQLAA          597
//

If you have problems or comments...

PBIL Back to PBIL home page