(data stored in ACNUC7421 zone)

EMBL: CP000489.PE11

CP000489.PE11        Location/Qualifiers
FT   CDS             9924..10529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0011"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: Ham1 family protein; KEGG: rde:RD1_0427 Ham1
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68128"
FT                   /db_xref="GOA:A1AXY4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1AXY4"
FT                   /protein_id="ABL68128.1"
FT                   /translation="MRRLTERKLLVATHNKGKLDEIRAMMAPHGIEVTSAGEMGLPEPA
FT                   ETESSFIGNARIKARAAMQATGLPVLADDSGITVDGLDGAPGVYTADWAETPNGRDFMQ
FT                   AMTRTWTELDERGAPEPRTAQFRATLILLWPDGHEEIFEGVAPGRLVWPPRGAHGHGYD
FT                   PIFVPDGHDVTYAEMPSEQKNAISHRARAFRKLETLFA"
     MRRLTERKLL VATHNKGKLD EIRAMMAPHG IEVTSAGEMG LPEPAETESS FIGNARIKAR        60
     AAMQATGLPV LADDSGITVD GLDGAPGVYT ADWAETPNGR DFMQAMTRTW TELDERGAPE       120
     PRTAQFRATL ILLWPDGHEE IFEGVAPGRL VWPPRGAHGH GYDPIFVPDG HDVTYAEMPS       180
     EQKNAISHRA RAFRKLETLF A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page