(data stored in ACNUC7421 zone)

EMBL: CP000489.PE111

CP000489.PE111       Location/Qualifiers
FT   CDS             complement(102697..103602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68228"
FT                   /db_xref="GOA:A1AY84"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY84"
FT                   /protein_id="ABL68228.1"
FT                   /translation="MTKNNIAREQNSEPVLRFLKARTIVYRKANLLVGLQILLTAVVPA
FT                   LMAVAGIWLLDWKSLFALAGLSIALVDMLIIDRRLGKLSVDAAKLAEEFDCRLFSLPWS
FT                   EILVGQRLSPETVQGYVVKFRQKKEPAILNWYPEAVSTIPRYLGVLLCQRTNLWYDSEL
FT                   RSHYAALIKWAGVVGFILCFVLAWRLNYTLQTTVLSIFSPMFPFFAWSIRTYWRQTDVS
FT                   AAQARNLSSAETLWKQAVRGTLSETKLWPEIRDLQNAIYARRSASPLILPFLYSVLRPG
FT                   MENRMSVAAEKFIEDSGLNS"
     MTKNNIAREQ NSEPVLRFLK ARTIVYRKAN LLVGLQILLT AVVPALMAVA GIWLLDWKSL        60
     FALAGLSIAL VDMLIIDRRL GKLSVDAAKL AEEFDCRLFS LPWSEILVGQ RLSPETVQGY       120
     VVKFRQKKEP AILNWYPEAV STIPRYLGVL LCQRTNLWYD SELRSHYAAL IKWAGVVGFI       180
     LCFVLAWRLN YTLQTTVLSI FSPMFPFFAW SIRTYWRQTD VSAAQARNLS SAETLWKQAV       240
     RGTLSETKLW PEIRDLQNAI YARRSASPLI LPFLYSVLRP GMENRMSVAA EKFIEDSGLN       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page