(data stored in ACNUC7421 zone)

EMBL: CP000489.PE113

CP000489.PE113       Location/Qualifiers
FT   CDS             complement(105698..106597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0113"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: bmb:BruAb1_0274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68230"
FT                   /db_xref="GOA:A1AY86"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="PDB:3H16"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY86"
FT                   /protein_id="ABL68230.1"
FT                   /translation="MSANDRAIETLRREIAKLQTDGAAIARKDAGIRAKLASAMAAQAK
FT                   AKTAPALRLKQAEASRLEKELMATSKSQADIATKIAKKQSSLSAKLVVQANEAKKADAK
FT                   AKKNQERVSKTQEEATRKLEAGYRKLTLENQSLEQRLQRELSAMKPTAGPTTNADLTSA
FT                   PPHDIFISHAWEDKADFVEALAHTLRAAGAEVWYDDFSLRPGDSLRRSIDKGLGSSRFG
FT                   IVVLSTHFFKKEWPQKELDGLFQLESSGRSRILPIWHKVSKDEVASFSPTMADKLAFNT
FT                   STKSVDEIVADLMAIIRD"
     MSANDRAIET LRREIAKLQT DGAAIARKDA GIRAKLASAM AAQAKAKTAP ALRLKQAEAS        60
     RLEKELMATS KSQADIATKI AKKQSSLSAK LVVQANEAKK ADAKAKKNQE RVSKTQEEAT       120
     RKLEAGYRKL TLENQSLEQR LQRELSAMKP TAGPTTNADL TSAPPHDIFI SHAWEDKADF       180
     VEALAHTLRA AGAEVWYDDF SLRPGDSLRR SIDKGLGSSR FGIVVLSTHF FKKEWPQKEL       240
     DGLFQLESSG RSRILPIWHK VSKDEVASFS PTMADKLAFN TSTKSVDEIV ADLMAIIRD        299
//

If you have problems or comments...

PBIL Back to PBIL home page