(data stored in ACNUC7421 zone)

EMBL: CP000489.PE114

CP000489.PE114       Location/Qualifiers
FT   CDS             complement(106933..107211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0114"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; KEGG: rsp:RSP_6161
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68231"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY87"
FT                   /protein_id="ABL68231.1"
FT                   /translation="MRTHLAALLALMVAAGCAVGSGAVVKGVGPGDLLKLREGPGLEHN
FT                   IIIGLPDGTRLTRQNCVTNNGKVWCRVFLTDRPAISGYVSADYLAHR"
     MRTHLAALLA LMVAAGCAVG SGAVVKGVGP GDLLKLREGP GLEHNIIIGL PDGTRLTRQN        60
     CVTNNGKVWC RVFLTDRPAI SGYVSADYLA HR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page