(data stored in ACNUC7421 zone)

EMBL: CP000489.PE116

CP000489.PE116       Location/Qualifiers
FT   CDS             complement(108141..108776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0116"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: atc:AGR_L_286 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68233"
FT                   /db_xref="GOA:A1AY89"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY89"
FT                   /protein_id="ABL68233.1"
FT                   /translation="MDNYFESPFRGITLDQQVTNPNIVVGRYSYYSGYYHGHGFDDCAR
FT                   YLLPDEGADRLIIGSFCSIGSGAGFIMAGNQGHRNDWISSFPFYWMPEVPAFAGAANGY
FT                   QPVGDTVIGSDVWIGSEAVIMPGIRIGDGAVIGTRALVTRDVEPYAIVGGNPAKVIRKR
FT                   FDDRQIGLLLEMRWWDWSDEQLHAAIPLLTSGEVEGLHRYWLEKIRAA"
     MDNYFESPFR GITLDQQVTN PNIVVGRYSY YSGYYHGHGF DDCARYLLPD EGADRLIIGS        60
     FCSIGSGAGF IMAGNQGHRN DWISSFPFYW MPEVPAFAGA ANGYQPVGDT VIGSDVWIGS       120
     EAVIMPGIRI GDGAVIGTRA LVTRDVEPYA IVGGNPAKVI RKRFDDRQIG LLLEMRWWDW       180
     SDEQLHAAIP LLTSGEVEGL HRYWLEKIRA A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page