(data stored in ACNUC7421 zone)

EMBL: CP000489.PE117

CP000489.PE117       Location/Qualifiers
FT   CDS             109037..109393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68234"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY90"
FT                   /protein_id="ABL68234.1"
FT                   /translation="MTEIAPQPRIKLSKLRDIGWSLWDPIGLLDPESRAGRWDDEANLS
FT                   FADEYDGYLIAAASQLRRGTPRDEVVAFLVDIETRHMAMRDSPSVRLRAEAVVEAILAD
FT                   ETIWTWPDAQGRFG"
     MTEIAPQPRI KLSKLRDIGW SLWDPIGLLD PESRAGRWDD EANLSFADEY DGYLIAAASQ        60
     LRRGTPRDEV VAFLVDIETR HMAMRDSPSV RLRAEAVVEA ILADETIWTW PDAQGRFG         118
//

If you have problems or comments...

PBIL Back to PBIL home page