(data stored in ACNUC7421 zone)

EMBL: CP000489.PE118

CP000489.PE118       Location/Qualifiers
FT   CDS             109402..109755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC1987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68235"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY91"
FT                   /protein_id="ABL68235.1"
FT                   /translation="MTRHQIFTTSFASVYPHYVAKAEKKGRSRAEVDEIILWLTGYSPE
FT                   QLAARLQDRTDFETFFAQAPRMNPARSLIKGVVCGVQVEEVEDPLMREIRYLDKLIDEL
FT                   AKGKPTEKILRKG"
     MTRHQIFTTS FASVYPHYVA KAEKKGRSRA EVDEIILWLT GYSPEQLAAR LQDRTDFETF        60
     FAQAPRMNPA RSLIKGVVCG VQVEEVEDPL MREIRYLDKL IDELAKGKPT EKILRKG          117
//

If you have problems or comments...

PBIL Back to PBIL home page