(data stored in ACNUC7421 zone)

EMBL: CP000489.PE119

CP000489.PE119       Location/Qualifiers
FT   CDS             109994..110410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68236"
FT                   /db_xref="GOA:A1AY92"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY92"
FT                   /protein_id="ABL68236.1"
FT                   /translation="MILILLAVMLTALTCIVAWYLATWALPVMVAVETFRLAHATEAGF
FT                   LLSVLAAGTAALLSVGLVLLVLFKAKNPILCLLARAVFVIPAMIAGYAVVHGVTHDAID
FT                   SAIALKLLCGTAGLITGIAALINLNGFGELAPQA"
     MILILLAVML TALTCIVAWY LATWALPVMV AVETFRLAHA TEAGFLLSVL AAGTAALLSV        60
     GLVLLVLFKA KNPILCLLAR AVFVIPAMIA GYAVVHGVTH DAIDSAIALK LLCGTAGLIT       120
     GIAALINLNG FGELAPQA                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page