(data stored in ACNUC7421 zone)

EMBL: CP000489.PE123

CP000489.PE123       Location/Qualifiers
FT   CDS             113488..113898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0123"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: nha:Nham_4669 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68240"
FT                   /db_xref="GOA:A1AY96"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY96"
FT                   /protein_id="ABL68240.1"
FT                   /translation="MQNIVILAGTIRQAPETRTTRSGTDVTRFKLVTSRPLYSEGRVVR
FT                   DETGYRVEDAEWHRVVAFNGLGRTIQQYCESGTKVLVRGRIHYTKWQDAEGQDRYGCEI
FT                   VAETVDFLSRALQSEADDKDEGRFIDEDDIPS"
     MQNIVILAGT IRQAPETRTT RSGTDVTRFK LVTSRPLYSE GRVVRDETGY RVEDAEWHRV        60
     VAFNGLGRTI QQYCESGTKV LVRGRIHYTK WQDAEGQDRY GCEIVAETVD FLSRALQSEA       120
     DDKDEGRFID EDDIPS                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page