(data stored in ACNUC7421 zone)

EMBL: CP000489.PE124

CP000489.PE124       Location/Qualifiers
FT   CDS             113876..114208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68241"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY97"
FT                   /protein_id="ABL68241.1"
FT                   /translation="MKTTSPPEREAREPGGFSRRVFPCPHRIALRPRRPEKASRPDRPA
FT                   GKPPARACCLPPTPTQSFSREEETGAWERGWGARQRHRWALHGRQRVVANGELCFRAEG
FT                   EIGVRR"
     MKTTSPPERE AREPGGFSRR VFPCPHRIAL RPRRPEKASR PDRPAGKPPA RACCLPPTPT        60
     QSFSREEETG AWERGWGARQ RHRWALHGRQ RVVANGELCF RAEGEIGVRR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page