(data stored in ACNUC7421 zone)

EMBL: CP000489.PE125

CP000489.PE125       Location/Qualifiers
FT   CDS             114444..114647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68242"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY98"
FT                   /protein_id="ABL68242.1"
FT                   /translation="MHTATFEINIPGNPLAGRINLEDIEMGMDADTGVKARASRDSMTL
FT                   TVRVAANDAADAANWLRKMGLI"
     MHTATFEINI PGNPLAGRIN LEDIEMGMDA DTGVKARASR DSMTLTVRVA ANDAADAANW        60
     LRKMGLI                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page